This is a working overview of peptide fragment, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-07-21. Anything still debated is marked as such rather than presented as settled.
TB-500 is a laboratory label applied to a short synthetic peptide that is widely described as a fragment of thymosin beta-4, an actin-binding protein present in most mammalian cells. Suppliers and review articles usually present TB-500 as the N-terminal region of that protein, but the exact sequence attached to the name is not consistent across sources. Some product descriptions list a seven-residue chain; others use the label loosely for the parent protein itself. Because of that variation, any technical discussion of TB-500 needs to state which sequence is meant.
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
TB-500 refers to a synthetic peptide fragment derived from the actin-binding region of thymosin beta-4, a protein present in most mammalian cells. The full protein contains forty-three amino acids, while the commonly sold fragment is a much shorter acetylated sequence, often cited as LKKTETQ. The fragment retains part of the actin-binding motif but lacks the remainder of the parent protein. Material sold under this name is usually lyophilized powder intended for laboratory research, and it is not a finished pharmaceutical product.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilised powder | Sealed vial; reconstituted before laboratory use |
| Appearance | White to off-white solid | Visual descriptor used on certificates of analysis |
| Solubility class | Water-soluble | Dissolves in water and aqueous buffers |
| Reported mass, fragment | Near 889 Da | Value depends on the stated sequence |
| Reported mass, parent protein | Near 4963 Da | 43-residue thymosin beta-4 |
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
Thymosin beta-4 itself is a natural peptide of 43 residues found in many cell types and body fluids. Its best-characterised function is binding and sequestering actin monomers, which influences cytoskeletal dynamics. The sequence most often associated with TB-500, LKKTETQ, corresponds to part of that actin-binding region. A different fragment, Ac-SDKP, is also derived from the same parent peptide and is studied in its own right, which is one reason discussions of thymosin fragments can become confusing. The two are structurally distinct and are not interchangeable.
Lyophilised peptide powders are hygroscopic, and the fragment absorbs atmospheric moisture when a vial is opened at room temperature. Weighing and aliquoting are normally done quickly in a dry environment, and stock solutions are divided into single-use portions before freezing. Repeated freeze-thaw cycles are avoided because they promote aggregation and can shift the measured content of a vial. These practices are general to synthetic peptides rather than unique to this sequence, but they matter more for short chains kept for long periods.
The seven-residue chain carries several polar and charged side chains, so it dissolves readily in water and in aqueous buffers near neutral pH. No cysteine is present, so disulphide formation is not a concern and reducing agents are unnecessary. Dilute ammonium hydroxide or acetonitrile-water mixtures are sometimes used for stock solutions when initial dissolution is slow. Strongly alkaline conditions and prolonged contact with oxidising agents are avoided because they can modify lysine-containing stretches, and haze in solution usually signals incomplete dissolution or aggregated material.
The efficacy of lowering HbA1c in the gemigliptin group was generally consistent across the subgroups based on age (<65 or ≥65 years), gender, duration of T2DM (5, >5 to 10, or >10 years), and baseline body mass index (BMI, <25 or ≥25 kg/m2). In addition, gemigliptin groups led to a significantly greater inhibition of plasma DPP-4 compared to sitagliptin. This study was extended by 28 weeks in order to evaluate the long-term efficacy and safety of gemigliptin. All treatment groups showed clinically and statistically (P<0.0001) significant improvement in glycemic control from baseline after 52 weeks. The reduction from the baseline in HbA1c was –1.06 (95% CI, –1.28 to –0.85) in the patients who continued to receive gemigliptin 50 mg qd. Add-on to metformin and glimepiride In this multicenter, randomized, blinded, phase III study (study identifier: LG-DPCL010, TROICA study; ClinicalTrials.gov registration number: NCT01990469), eligible patients with inadequate glycemic control (7%≤HbA1c≤11%) were randomized to gemigliptin 50 mg qd (n=109) or placebo (n= 110). The baseline demographics were similar between groups (age, 60.9 years; BMI, 24.9 kg/m2; duration of T2DM, 12.9 years), with mean±standard deviation (SD) baseline HbA1c of 8.12%± 0.82% in the gemigliptin group and 8.15%±0.89% in the placebo group. At week 24, the adjusted mean±standard error change for HbA1c with gemigliptin was –0.88%±0.17% (change with placebo –0.01%±0.18%; difference –0.87%±0.12%; 95% CI, –1.09 to –0.64; P<0.0001).
Metabolic intermediates are compounds produced during the conversion of substrates (starting molecules) into final products in biochemical reactions within cells. Although these intermediates are of relatively minor direct importance to cellular function, they can play important roles in the allosteric regulation of enzymes, glycolysis, the citric acid cycle, and amino acid synthesis. Metabolic pathways consist of a series of enzymatically catalyzed reactions where each step transforms a substrate into a product that serves as the substrate for the next reaction. Metabolic intermediates are compounds that form during these steps, and they are neither the starting substrate nor the final product of the pathway. These intermediates are crucial because they allow for regulation, energy storage, and extraction of chemical energy in a controlled manner.
==== Sub-Divisions ==== Each Sub-Division is headed by one Police officer of the rank Deputy Superintendent of Police (members of West Bengal Police Service, a directly recruited officer or one promoted from the ranks) or an Assistant Superintendent of Police (members of Indian Police Service). In West Bengal, the officer who heads a Sub-Division is known as SDPO i.e. Sub Divisional Police Officer.
Sources: en.wikipedia.org
==== Alternative medicine ==== The scalp must be cleaned from sebum, sweat, and dirt, prior to topical application, for agents to penetrate it. A 2020 systemic review on agents used to treat androgenic alopecia found that:
Tylosin is a macrolide antibiotic and bacteriostatic feed additive used in veterinary medicine. It has a broad spectrum of activity against Gram-positive organisms and a limited range of Gram-negative organisms. It is found naturally as a fermentation product of Streptomyces fradiae. Tylosin is used in veterinary medicine to treat bacterial infections in a wide range of species and has a high margin of safety. It has also been used as a growth promotant in some species, and as a treatment for colitis in companion animals.
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
Sources: en.wikipedia.org
=== Cell migration === Histatins enhance migration in oral keratinocytes, fibroblasts, and endothelial cells. By increasing the number of fibroblast cells, histatin improves collagen deposition as well. Histatin 1 activates Rac1 GTPase through the RIN2/Rab5 signaling axis, facilitating cell adhesion and vascular morphogenesis.
== Cells in APUD system == Anterior pituitary Neurons of hypothalamus Chief cells of parathyroid Adrenal medullary cells Glomus cells in carotid body Melanocytes of skin Cells of pineal gland Renin producing cells in the kidney
Honey use and production has a long and varied history, with its beginnings in prehistoric times. Several cave paintings in Cuevas de la Araña in Spain depict humans foraging for honey at least 8,000 years ago. While Apis mellifera is an Old World insect, large-scale meliponiculture of New World stingless bees has been practiced by Mayans since pre-Columbian times.
Sources: en.wikipedia.org
No. TB-500 is a trade-style label used for a synthetic peptide described as a fragment of thymosin beta-4, while thymosin beta-4 is the full 43-residue protein. The two differ in size and are not interchangeable terms in analytical work.
Naming for research peptides is not standardised, and suppliers sometimes apply the same label to different chain lengths. Certificates of analysis and mass data are the practical way to determine what a given lot contains.
The fragment commonly cited under this label is reported near 889 Da, and the parent protein near 4963 Da. Reported values shift with the exact sequence and with residual counter-ions or water in the sample.
TB-500 is a name used for a short synthetic peptide fragment taken from the actin-binding region of thymosin beta-4. Material sold under this label is usually a lyophilized powder supplied for laboratory research rather than a licensed medicine. The commonly cited sequence is LKKTETQ.