reversed-phase HPLC is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-09-05. Where a claim depends on a specific study, the study is described rather than over-claimed.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
Animal work has examined the peptide in models of cardiac injury, skin wounding, and corneal repair, with reported outcomes covering cell migration, inflammatory cell influx, and tissue remodeling. Several of those experiments used the full-length protein or longer fragments instead of the seven-residue sequence, which makes direct comparison between reports difficult. Results are generally described as tissue-dependent, and effect sizes vary considerably across laboratories. Independent replication is uneven, so the overall picture is incomplete rather than settled.
| Property | Value | Notes |
|---|---|---|
| Purity determination | Reversed-phase HPLC | UV detection commonly at 214 nm |
| Mass confirmation | Mass spectrometry | Compared against theoretical 888.5 Da |
| Powder storage | -20 C or below | Dry and protected from light |
| Reconstituted storage | Aliquoted and frozen | Avoid repeated freeze-thaw cycles |
| Reconstitution solvent | Sterile water or neutral buffer | Avoid extreme pH conditions |
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
Research peptides are typically supplied as a white to off-white lyophilised powder in a sealed vial. The dry solid is more stable than a solution and is normally kept refrigerated or frozen until use. Dissolution is usually done in water, phosphate-buffered saline or a similar aqueous medium, depending on the assay. Because the material is hygroscopic and easily contaminated, opening vials in a low-humidity environment and recording the lot number before use are standard laboratory practices.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Identity and purity are checked with reversed-phase high-performance liquid chromatography, which separates the target sequence from truncated or deletion analogues, and with mass spectrometry, which confirms the expected molecular mass. Amino acid analysis and peptide mapping give orthogonal confirmation but are used less often outside specialist laboratories. Counter-ion content varies: material purified on trifluoroacetic acid gradients retains trifluoroacetate, and ion exchange can convert the salt form. Residual water and solvent are measured by Karl Fischer titration or thermogravimetric analysis, and any purity figure should be read together with the method used to obtain it.
Lyophilised peptide powders are hygroscopic, and the fragment absorbs atmospheric moisture when a vial is opened at room temperature. Weighing and aliquoting are normally done quickly in a dry environment, and stock solutions are divided into single-use portions before freezing. Repeated freeze-thaw cycles are avoided because they promote aggregation and can shift the measured content of a vial. These practices are general to synthetic peptides rather than unique to this sequence, but they matter more for short chains kept for long periods.
The seven-residue chain carries several polar and charged side chains, so it dissolves readily in water and in aqueous buffers near neutral pH. No cysteine is present, so disulphide formation is not a concern and reducing agents are unnecessary. Dilute ammonium hydroxide or acetonitrile-water mixtures are sometimes used for stock solutions when initial dissolution is slow. Strongly alkaline conditions and prolonged contact with oxidising agents are avoided because they can modify lysine-containing stretches, and haze in solution usually signals incomplete dissolution or aggregated material.
The most frequently cited identity is a seven-residue fragment with the sequence LKKTETQ, taken from the actin-binding domain of the parent protein. A separate molecule, N-acetyl-seryl-aspartyl-lysyl-proline, often shortened to Ac-SDKP, derives from the same protein's N-terminal region and appears in overlapping literature. Reported molecular masses therefore differ between sources, and a mass value on its own does not establish which fragment is present. Confirmation requires a defined sequence rather than a single number.
Research interest in thymosin beta-4 fragments centres on actin sequestration, cell migration and tissue repair models. Most published work uses cultured cells or animal wound and cardiac preparations, and findings are generally described as preliminary. No fragment of this protein has been approved as a therapeutic product by major regulators. Reviews of the field note inconsistent dosing, delivery routes and outcome measures across studies, which complicates direct comparison. The material is best understood as a laboratory reagent with an active but unresolved research literature.
TB-500 is a catalogue name applied to a synthetic peptide related to thymosin beta-4, an actin-binding protein found in most mammalian cells. Suppliers do not use the label consistently: some describe it as the full 43-residue protein, others as a short fragment from the actin-binding region, and others as a related tetrapeptide. Because the name is commercial rather than chemical, two products sold under it may not contain the same molecule. This naming ambiguity is the first point to check in any description of the material.
== Double crush syndrome == Double crush syndrome is a theory of nerve injury first proposed by Upton and Thomas in 1972. The double crush theory is considered to be somewhat controversial, as there are disagreements over its existence and the underlying mechanisms that could produce it. It posits that neural function is impaired because single axons, having been compressed at one site, are susceptible to further neuropathy due to injury at another site. This is due to impairment of the anterograde axonal transport mechanism, and with multiple lesions impairing anterograde axonal transport, the anterograde transport system will be most impacted just distal to the most distal entrapment. The basis of this theory was the high rate of cervical radiculopathy seen in patients with carpal tunnel syndrome. Conceptually, this is analogous to multiple water filters in a filtration system (one for large particles, one for bacteria, etc). The water will be cleanest just past the last filter, but the filtration was due to the combined effects of the separate filters. To disable filtration, each of the filters must be removed rather than the last filter. The structure of peripheral nerves includes a small cell body at the spinal cord, and a very long axon that extends all the way to the innervation target. These nerves are as long as 1-1.5 meters (sciatic nerve). Most of the substances the axon needs to survive is manufactured in the cell body. The axon's survival depends on its connection with the cell body, supported by the axonal transport mechanisms to carry cellular material.
=== Gene === The human LECT2 gene, LECT2, is located on the long, i.e., "q", arm of chromosome 5 at position q31.1 (notated as 5q31.1). This location is close to several immune modulating genes including interleukins 3, 5, and 9 and granulocyte-macrophage colony stimulating factor. LECT2 is conserved in zebrafish, chicken, rat, mouse, cow. dog, Rhesus monkey, and chimpanzee. Human LECT2 is composed of 4 exons, 3 introns, and ~8,000 base pairs. The gene has numerous single nucleotide variants as well as other variations, two of which (see Pathophysiology section) have been associated with human disease. Human LECT2 has several different transcriptional initiation sights and codes for a mRNA composed of 1,000 to 1,300 ribonucleotides. mRNA for LECT2 is highly expressed in liver tissue and expressed at far lower levels in a wide range of other tssues.
== Interactions == The drug transfers into breast milk. There is no evidence that its use during pregnancy is harmful to the developing fetus and its use is not contraindicated in pregnancy. The concurrent use of hydroxychloroquine and the antibiotic azithromycin appears to increase the risk for certain serious side effects with short-term use, such as an increased risk of chest pain, congestive heart failure, and mortality from cardiovascular causes. Care should be taken if combined with medication altering liver function as well as aurothioglucose (Solganal), cimetidine (Tagamet) or digoxin (Lanoxin). Hydroxychloroquine can increase plasma concentrations of penicillamine which may contribute to the development of severe side effects. It enhances hypoglycemic effects of insulin and oral hypoglycemic agents. Dose altering is recommended to prevent profound hypoglycemia. Antacids may decrease the absorption of hydroxychloroquine. Both neostigmine and pyridostigmine antagonize the action of hydroxychloroquine. While there may be a link between hydroxychloroquine and hemolytic anemia in those with glucose-6-phosphate dehydrogenase deficiency, this risk may be low in those of African descent. Specifically, the US Food and Drug Administration's (FDA) drug label for hydroxychloroquine lists the following drug interactions:
That is, in retinas exposed to only dim light, calcium levels are high in retinal rod cells and recoverin is bound to and inhibits rhodopsin kinase, leaving rhodopsin exquisitely sensitive to photons to mediate low-light, low-acuity vision; in bright light, rod cell calcium levels are low so recoverin cannot bind or inhibit rhodopsin kinase, resulting in greater rhodopsin kinase/arrestin inhibition of rhodopsin signaling at baseline to preserve visual sensitivity. According to a proposed model, the N-terminus of rhodopsin kinase is involved in its own activation. It's suggested that an activated rhodopsin binds to the N-terminus, which is also involved in the stabilization of the kinase domain to induce an active conformation.
Theraflu (made by Novartis) — previously contained pseudoephedrine, now contains phenylephrine Trima — contains 60 mg pseudoephedrine hydrochloride Tylol Hot (made by NOBEL İLAÇ SANAYİİ VE TİCARET A.Ş., Turkey) — a packet of 20 g contains 60 mg pseudoephedrine hydrochloride, 500 mg paracetamol and 4 mg chlorpheniramine maleate Unifed (made by United Pharmaceutical Manufacturer, Jordan) — contains pseudoephedrine hydrochloride (also triprolidine and guaifenesin). Zyrtec-D 12 Hour (made by McNeil Consumer Healthcare, a Kenvue company) — contains 120 mg pseudoephedrine hydrochloride (also 5 mg of cetirizine). Zephrex-D (made by Westport Pharmaceuticals) – a special meth-resistant form of pseudoephedrine that becomes gooey when heated.
Sources: en.wikipedia.org
==== Compounds ==== Polonium has no common compounds, and almost all of its compounds are synthetically created; more than 50 of those are known. The most stable class of polonium compounds are polonides, which are prepared by direct reaction of two elements. Na2Po has the antifluorite structure, the polonides of Ca, Ba, Hg, Pb and lanthanides form a NaCl lattice, BePo and CdPo have the wurtzite and MgPo the nickel arsenide structure. Most polonides decompose upon heating to about 600 °C, except for HgPo that decomposes at ~300 °C and the lanthanide polonides, which do not decompose but melt at temperatures above 1000 °C. For example, the polonide of praseodymium (PrPo) melts at 1250 °C, and that of thulium (TmPo) melts at 2200 °C. PbPo is one of the very few naturally occurring polonium compounds, as polonium alpha decays to form lead. Polonium hydride (PoH2) is a volatile liquid at room temperature prone to dissociation; it is thermally unstable. Water is the only other known hydrogen chalcogenide which is a liquid at room temperature; however, this is due to hydrogen bonding. The three oxides, PoO, PoO2 and PoO3, are the products of oxidation of polonium. Halides of the structure PoX2, PoX4 and PoF6 are known. They are soluble in the corresponding hydrogen halides, i.e., PoClx in HCl, PoBrx in HBr and PoI4 in HI. Polonium dihalides are formed by direct reaction of the elements or by reduction of PoCl4 with SO2 and with PoBr4 with H2S at room temperature. Tetrahalides can be obtained by reacting polonium dioxide with HCl, HBr or HI.
== Behavior informatics == Behavior informatics, also called behavior computing, explores behavior intelligence and behavior insights from the informatics and computing perspectives. Different from applied behavior analysis from the psychological perspective, behavior informatics builds computational theories, systems and tools to qualitatively and quantitatively model, represent, analyze, and manage behaviors of individuals, groups and/or organizations.
== In France == Raymond arrived in Europe in 1922 and settled in Paris in 1927. He nonetheless retained links with the newly formed republic of Turkey, and prepared sketches for Turkey's projected participation in the 1925 International Exposition of Decorative Arts in Paris.
=== Simple versus differential === Simple Staining is a technique that only uses one type of stain on a slide at a time. Because only one stain is being used, the specimens (for positive stains) or background (for negative stains) will be one color. Therefore, simple stains are typically used for viewing only one organism per slide. Differential staining uses multiple stains per slide. Based on the stains being used, organisms with different properties will appear different colors allowing for categorization of multiple specimens. Differential staining can also be used to color different organelles within one organism which can be seen in endospore staining.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Sources: en.wikipedia.org
Tyrosine and phenylalanine are biosynthesized from prephenate, which is converted to an amino acid-specific intermediate. This process is mediated by a phenylalanine (PheA) or tyrosine (TyrA) specific chorismate mutase-prephenate dehydrogenase. PheA uses a simple dehydrogenase to convert prephenate to phenylpyruvate, while TyrA uses a NAD-dependent dehydrogenase to make 4-hydroxylphenylpyruvate. Both PheA and TyrA are feedback inhibited by their respective amino acids. Tyrosine can also be inhibited at the transcriptional level by the TyrR repressor. TyrR binds to the TyrR boxes on the operon near the promoter of the gene that it wants to repress. Tryptophan biosynthesis involves conversion of chorismate to anthranilate using anthranilate synthase. This enzyme requires either glutamine as the amino group donor or ammonia itself. Anthranilate synthase is regulated by the gene products of trpE and trpG. trpE encodes the first subunit, which binds to chorismate and moves the amino group from the donor to chorismate. trpG encodes the second subunit, which facilitates the transfer of the amino group from glutamine. Anthranilate synthase is also regulated by feedback inhibition: tryptophan is a co-repressor to the TrpR repressor.
== Names == The war is also known under other names, such as the Second Gulf War (not to be confused with the 2003 Iraq War, also referred to as such), Persian Gulf War, Kuwait War, or Iraq War before the term "Iraq War" became identified with the 2003 Iraq War, also known in the US as "Operation Iraqi Freedom". The war was named Umm al-Ma'arik ("mother of all battles") by Iraqi officials. After the US invasion of Iraq in 2003, the Gulf War of 1990–1991 is often known as the "First Iraq War". The following names have been used to describe the conflict itself: Gulf War and Persian Gulf War are the most common terms for the conflict used within western countries. It may also be called the First Gulf War, to distinguish it from the 2003 invasion of Iraq and the subsequent Iraq War. Some authors have called it the Second Gulf War to distinguish it from the Iran–Iraq War. Liberation of Kuwait (Arabic: تحرير الكويت) (taḥrīr al-kuwayt) is the term used by Kuwait and most of the coalition's Arab states, including Saudi Arabia, Bahrain, Egypt, and the United Arab Emirates. Terms in other languages include French: la Guerre du Golfe and Guerre du Koweït (War of Kuwait); German: Golfkrieg (Gulf War) and Zweiter Golfkrieg (Second Gulf War).
==== Egg ==== The cabbage looper eggs are generally yellow-white in color, dome-shaped, and patterned with ridges. They are 0.6mm in diameter and 0.4mm in height, and they are usually laid singly on the underside of leaves. In one day, 40–50 females can lay 1000–2000 viable eggs. Viable eggs hatch after about three days, while unviable eggs fail to develop and collapse within that period. Eggs are mostly found on leaves that are both larger and higher on the plant. It is not clear why eggs are preferentially laid on these leaves.
== Research and career == Badu-Tawiah was appointed assistant professor at the Ohio State University in 2014. His research considers new mass spectrometry techniques for the detection of disease. Mass spectrometry offers several advantages over macrofluidic platforms, as they remain stable. To achieve this he makes use of cleavable ionic probes that can be used to perform immunoassays. These probes can be attached to antibodies and mounted to a flexible substrate for screening without refrigeration. He made use of wax ink to trace out the outline of the channels of the device, forming a waterproof barrier that separates that safely captures and stores the blood sample. Badu-Tawiah has worked on devices that can allow the early-detection of malaria and Zika virus. In 2016 he demonstrated that these simple diagnostic tests were able to accurately diagnose whether someone was infected with malaria up to one month after blood was collected, and that patients could send them by mail to research labs. Alongside malaria diagnosis, the tests are capable of identifying the cancer antigens that are markers for cancers of the large intestine. Alongside disease detection, Badu-Tawiah works on novel analytical devices for photo- and electro-catalytic screening.
Some longitudinal incisions of 2mm of depth have to be made through the skin to proceed to the extraction of latex, which can be collected in solid form some minutes after the extraction. The proteases present in the latex of the fruit are inactive precursors that are activated once the papaya is wounded. In 0.3 ml of latex there are about 15 mg of chymopapain. If we want to conserve the proteolytic properties, latex has to be preserved with sodium metabisulfite and stored at a low temperature of about -10 °C. If used immediately after the incisions, a buffer is added to extract the proteins: EDTA, ammonium sulfate or phosphate buffer all with a concentration of 0.5 mM and a pH of 7. It is also important to block the thiol functions to avoid air oxidation and the loss of proteolytic activity. To eliminate organic and insoluble molecules, the sample is first filtered and afterwards centrifuged at 11000g for 30min. The pellet is discarded and the supernatant added to 96% alcohol with a ratio of 1:3. Impurities precipitate and can be eliminated by filtration. Afterwards, (NH4)2SO4 fractioning is done by addition of this substance at a concentration of 0.472 mg/ml. Chymopapain precipitates and can be retrieved through another centrifugation, again at 11000g for 30min. The supernatant is discarded and the ion exchange chromatography can be carried out, with a linear gradient of 100mM (Na+) and different volumes of elution. Studying A280 chymopapain is found in the fraction of 750-1000 ml.
Sources: en.wikipedia.org
The lyophilised powder is typically held at -20 C or lower in a dry, dark place. Reconstituted solutions are aliquoted and frozen to avoid repeated freeze-thaw cycles.
Mass spectrometry is the usual confirmatory method because it measures the intact mass. Reversed-phase chromatography is used alongside it to estimate purity.
Not directly. Reported percentages depend on the chromatographic method, detection wavelength, and integration criteria, so the underlying method details matter.
The leading proposal involves sequestration of monomeric actin, which would alter cytoskeletal turnover and cell movement. The actin-binding motif shared with the parent protein is central to that idea. Direct confirmation in whole organisms remains limited.