thymosin beta-4 raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-02-23 and is reviewed periodically as new material appears.
The seven-residue chain carries several polar and charged side chains, so it dissolves readily in water and in aqueous buffers near neutral pH. No cysteine is present, so disulphide formation is not a concern and reducing agents are unnecessary. Dilute ammonium hydroxide or acetonitrile-water mixtures are sometimes used for stock solutions when initial dissolution is slow. Strongly alkaline conditions and prolonged contact with oxidising agents are avoided because they can modify lysine-containing stretches, and haze in solution usually signals incomplete dissolution or aggregated material.
Identity and purity are checked with reversed-phase high-performance liquid chromatography, which separates the target sequence from truncated or deletion analogues, and with mass spectrometry, which confirms the expected molecular mass. Amino acid analysis and peptide mapping give orthogonal confirmation but are used less often outside specialist laboratories. Counter-ion content varies: material purified on trifluoroacetic acid gradients retains trifluoroacetate, and ion exchange can convert the salt form. Residual water and solvent are measured by Karl Fischer titration or thermogravimetric analysis, and any purity figure should be read together with the method used to obtain it.
Lyophilised peptide powders are hygroscopic, and the fragment absorbs atmospheric moisture when a vial is opened at room temperature. Weighing and aliquoting are normally done quickly in a dry environment, and stock solutions are divided into single-use portions before freezing. Repeated freeze-thaw cycles are avoided because they promote aggregation and can shift the measured content of a vial. These practices are general to synthetic peptides rather than unique to this sequence, but they matter more for short chains kept for long periods.
Identity and purity are assessed with a small set of standard techniques. Reverse-phase high-performance liquid chromatography gives a purity estimate from peak area, usually recorded at 214 or 220 nanometers, where the peptide bond absorbs. Mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidized species. Amino acid analysis or tandem mass spectrometry sequencing can verify the sequence itself. Additional quality attributes include water content, residual trifluoroacetic acid carried over from purification, and endotoxin where the material is intended for biological work.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
| Property | Value | Notes |
|---|---|---|
| Water content | Low in freshly lyophilised material | Rises after repeated opening of the same vial |
| Solution stability | Lower than powder stability | Frozen aliquots are preferred over repeated thawing |
| Purity assessment | Reversed-phase HPLC with UV detection | Peak-area percentage excludes salts and water |
| Salt form | Often the trifluoroacetate salt | Retained from acidic purification gradients |
| Light sensitivity | Not strongly photoreactive | Dark storage still advised for long-term keeping |
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
Purity and identity are separate measurements and are often confused. Reverse-phase high-performance liquid chromatography, usually with ultraviolet detection near 214 nanometres, reports the share of total peak area belonging to the target compound. Mass spectrometry by electrospray or matrix-assisted laser desorption then checks whether the observed mass matches the expected sequence. Neither measurement alone shows that a vial holds the intended peptide. Peptide content, meaning the fraction of vial mass that is genuine peptide rather than counter-ion, water or residual acid, is reported separately and is frequently lower than the stated purity figure.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
Literature and online discussion often conflate TB-500 with full-length thymosin beta-4, even though the two differ in size and are not interchangeable in analytical terms. The fragment is produced by solid-phase peptide synthesis, and the product is a defined seven-residue chain rather than a biological extract. Because the term is a trade-style label, two vendors may supply materials of the same nominal sequence but different counter-ion content, purity, or water content. Comparisons across studies are therefore difficult unless the exact sequence and purity are reported.
TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.
Thymosin beta-4 itself is a small, widely expressed protein that sequesters monomeric actin and participates in cell migration, angiogenesis, and tissue repair. Researchers have examined the shortened fragment as a possible mimic of some of these activities, reasoning that the actin-binding motif lies within the first few residues. Binding to monomeric actin has been observed in cell-free systems. Whether the fragment reproduces the broader effects of the full protein in living tissue remains an open question, and findings from animal models are frequently cited without a clear bridge to human physiology.
Discussion of TB-500 appears in several distinct literatures that rarely cite one another. Peer-reviewed studies usually describe in vitro assays or small animal experiments and are cautious about extrapolation. Veterinary and sports communities circulate anecdotal reports with limited methodological detail. Commercial listings add a third layer, often using the name interchangeably with thymosin beta-4 even though the two molecules differ in size and sequence. Regulatory status varies by country, and the compound is not a licensed medicine in most jurisdictions, so readers comparing sources should check which molecule and which purity each source actually describes.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Americium-241 (241Am, Am-241) is an isotope of americium. Like all isotopes of americium, it is radioactive, with a half-life of 432.6 years. 241Am is the most common isotope of americium as well as the most prevalent americium isotope in radioactive waste. It is used in ionization-type smoke detectors and is a potential fuel for long-lifetime radioisotope thermoelectric generators (RTGs). Its common parent nuclides are 241Pu (by beta decay), 241Cm (by electron capture), and 245Bk (by alpha decay). 241Am is fissile, with the critical mass of a bare sphere of 57.6–75.6 kilograms (127.0–166.7 lb) (diameter of 19–21 centimetres (7.5–8.3 in)). Americium-241 has a specific activity of 3.43 Ci/g (126.91 GBq/g). It is commonly found in the form of americium-241 dioxide (241AmO2). The presence of 241Am in plutonium is determined by the original concentration of plutonium-241 (which decays to it) and its age. Older samples of plutonium containing 241Pu build up 241Am and may require chemical removable of americium-241 (e.g., during reworking of plutonium's pits).
== Mechanism of action == Troglitazone, like the other thiazolidinediones (pioglitazone and rosiglitazone), works by activating peroxisome proliferator-activated receptors (PPARs). Troglitazone is a ligand to both PPARα and – more strongly – PPARγ. Troglitazone also contains an α-Tocopherol moiety, potentially giving it vitamin E-like activity in addition to its PPAR activation. It has been shown to reduce inflammation. Troglitazone use was associated with a decrease of nuclear factor kappa-B (NF-κB) and a concomitant increase in its inhibitor (IκB). NFκB is an important cellular transcription regulator for the immune response.
=== 2009 === A report prepared for the British House of Lords comes to the conclusion that "The precise circumstances surrounding the August 2008 outbreak of the conflict are not yet clear but responsibility for the conflict was shared, in differing measures, by all the parties. There is evidence of a Russian military build-up prior to the August war." On 17 February 2009, the commanding General of the United States Army Europe Carter Ham commented on the training of Georgian military that the United States had trained the Georgian military for Iraq in the previous years, not for the defense of the homeland against Russia. In May 2009, anonymous European diplomat told The New York Times that NATO officials were told in April 2008 by Russia's defense chief that Georgia would be invaded later that year. In July 2009, Alexander Bastrykin, Chairman of the Investigative Committee of the Prosecutor General's Office, told journalists that the investigation of the war was almost complete. However, the guilt of Georgian president Mikheil Saakashvili in instigating the conflict in South Ossetia could not be proven. In September 2009, first president of the Czech Republic Václav Havel, Otto von Habsburg and other European politicians and thinkers wrote: "First, a big power will always find or engineer a pretext to invade a neighbour whose independence it resents. We should remember that Hitler accused the Poles of commencing hostilities in 1939, just as Stalin pinned the blame on the Finns when he invaded their country in 1940.
==== Disadvantages ==== Low solubility Short half-life Sometimes phospholipid undergoes oxidation and hydrolysis-like reaction Leakage and fusion of encapsulated drug/molecules Production cost is high Fewer stables
Sources: en.wikipedia.org
The least expensive diffusion pump oils are based on hydrocarbons which have been purified by double-distillation. Compared with the other fluids, they have higher vapor pressure, so are usually limited to a pressure of 1×10−6 Torr (1.3×10−4 Pa). They are also the most likely to burn or explode if exposed to oxidizers. For pumping reactive species, usually a polyphenyl ether based oil is used. These oils are the most chemical and heat resistant type of diffusion pump oil.
==== Acid pigmentation ==== In 2009 Luigi Garlaschelli, professor of organic chemistry at the University of Pavia, stated that he had made a full-size reproduction of the Shroud of Turin using only medieval technologies. His cloth was woven in the exact same manner and herringbone pattern by yarn type and weight as the Shroud. Garlaschelli placed a linen sheet over a volunteer and then rubbed it with an acidic pigment for the body. The shroud was then aged in an oven before being washed to remove the pigment. He then added blood stains, scorches and water stains to replicate the original. Giulio Fanti, professor of mechanical and thermic measurements at the University of Padua, commented that "the technique itself seems unable to produce an image having the most critical Turin Shroud image characteristics". Garlaschelli noted that the microscopic properties of his reproductions can't be exactly identical to the original, as accelerated and artificial aging lasting 4 hours cannot replicate the natural centuries the Shroud of Turin has gone through. He therefore considered the criticisms of those who claim a need for an absolute similarity as specious. Garlaschelli's reproduction was shown in a 2010 National Geographic documentary. Garlaschelli's technique included the bas-relief approach (described below) but only for the image of the face. The resultant image was visibly similar to the Turin Shroud, though lacking the uniformity and detail of the original.
Moe's Southwest Grill, referred to informally as Moe's, is an American fast casual restaurant franchise chain that was founded in Atlanta, Georgia, on December 9, 2000, by Raving Brands. The name "Moe's" originated as an acronym for "Musicians, Outlaws and Entertainers", and this theme led to the music-related artwork found in the original design. Moe's Southwest Grill—together with Schlotzsky's, Carvel, Cinnabon, McAlister's Deli, Jamba and Auntie Anne's brands—is part of the GoTo Foods portfolio of brands. GoTo is an affiliate of the Roark Capital Group. The restaurant chain originally featured artwork depicting deceased music legends and licensed a special rock soundtrack from Muzak that consisted of music from deceased musicians or bands with a notable deceased musician. After a lawsuit from the estate of Jerry Garcia, depictions of actual people were removed from the decor. The menu, which initially featured puns based on people and popular phrases from music, television, and movies was revamped to remove nearly all phrases that may result in legal issues.
The effects of 2C-B were reported by Shulgin to include sensory enhancement, brightened colors, visual richness, mental imagery, psychedelic visuals including kaleidoscopic and organic forms, sound distortion, increased appreciation of art and music, passivity, relaxation, emotional changes, euphoria, increased body awareness, tactile enhancement, feeling like waves of energy are flowing through oneself, feeling like one's body is flooded with orgasms, and sexual enhancement. He has succinctly described 2C-B as having "a luxury of sensory enhancement (visual, sexual, gustatory) with a minimum of introspective demands". The drug was one of his favorite psychedelics and one of his "magical half-dozen" most important psychedelic phenethylamines. At doses of 8 to 10 mg, 2C-B was described as consistently producing substantial sensory enhancement, but as not "superimposing hallucinogenesis" or as having "no hallucinogenic effects", with the state being described as quite distinct from that usually associated with psychedelics. It was also said to lack the lassitude that can be associated with psilocybin.
In May 2023, the FDA approved the iLet Bionic Pancreas system for people with Type 1 diabetes of six years and older. The device uses a closed-loop system to deliver both insulin and glucagon in response to sensed blood glucose levels. The 4th generation iLet prototype, presented in 2017, is around the size of an iPhone, with a touchscreen interface. It contains two chambers for both insulin and glucagon, and the device is configurable for use with only one hormone, or both. A 440-patient study of type I diabetes ran in 2020 and 2021 using a device configuration that delivered only insulin in comparison to standard of care; device use led to better circulating glucose control (measured by continuous monitoring) and a reduction in glycated hemoglobin (versus no change for the standard of care group). However, the incidence of severe hypoglycemic events was more than 1.5 times higher among device users versus standard care patients. There are several non-commercial, non-FDA approved DIY options, using open source code, including OpenAPS, Loop, and/or AndroidAPS.
Sources: en.wikipedia.org
Divide it into single-use aliquots and hold them frozen at -20 °C or below, protected from light. Repeated thawing of one container is the main avoidable source of variability.
Mass spectrometry confirms identity, because the measured mass is compared with the value expected from the sequence. Chromatography mainly reports how much of the material elutes as the target peak.
It usually describes the share of the chromatographic peak area recorded at a set wavelength. Salts, residual water, and solvent are excluded from that number, so it is not the same as mass fraction.
Short transit at ambient temperature is generally tolerated, but long-term storage at room temperature is not recommended. Heat, moisture, and light all accelerate degradation. Cold, dry, dark storage is the conventional choice.