Ac-LKKTETQ is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-12-19. Numbers and descriptions here follow the published literature rather than marketing material.
Reconstitution practices affect downstream measurements. The dry powder is typically dissolved in sterile water or a suitable aqueous buffer, then mixed gently rather than vortexed at high speed. Visible particles or cloudiness suggest incomplete dissolution or contamination and should be investigated. For long-term storage, aliquots should be labeled with concentration, solvent, and date. Open questions include how different buffers alter peptide conformation and whether specific container materials adsorb the peptide. Those variables can change apparent concentration in assays even when the chemical identity is correct.
Lyophilized TB-500 is hygroscopic and should be kept dry before use. The usual storage recommendation for the solid is -20 °C, protected from light and moisture. Once dissolved, the peptide is less stable, and repeated freeze-thaw cycles can promote aggregation or degradation. Laboratories often divide a reconstituted solution into single-use aliquots and store them at -80 °C. Exact stability limits depend on buffer, pH, and concentration, so published data do not define a single universal condition.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Interest in the peptide grew during the 2000s and 2010s, when studies of tendon and ligament injuries in horses reported changes in lesion size after treatment. Those reports circulated widely outside the scientific literature and shaped much of the current online discussion. Subsequent reviews noted inconsistent study design, small groups, and a shortage of independent replication. Popular descriptions often blur the line between the fragment, the complete protein, and unrelated growth factors, which complicates comparisons across sources.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
| Property | Value | Notes |
|---|---|---|
| Storage temperature (dry) | -20 °C | Protected from light and moisture |
| Storage temperature (solution) | -80 °C | Single-use aliquots recommended |
| Identity assay | LC-MS or MALDI-TOF | Confirms mass near 889 Da |
| Purity assay | RP-HPLC | Reports main peak percentage |
| Common impurities | Truncated peptides, deamidated forms | Arise from synthesis or storage |
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
Research peptides are typically supplied as a white to off-white lyophilised powder in a sealed vial. The dry solid is more stable than a solution and is normally kept refrigerated or frozen until use. Dissolution is usually done in water, phosphate-buffered saline or a similar aqueous medium, depending on the assay. Because the material is hygroscopic and easily contaminated, opening vials in a low-humidity environment and recording the lot number before use are standard laboratory practices.
Detection in biological samples relies on mass spectrometry, typically liquid chromatography coupled to tandem mass spectrometry after peptide extraction and enrichment. Intact peptides can also be confirmed by high-resolution mass measurement together with fragmentation data. Detection windows in urine are short because the peptide is degraded by proteases and cleared quickly, and concentrations are low. Many jurisdictions treat the compound as a prohibited substance in sport, grouped with peptide hormones and related factors, while it is not an approved therapeutic product. Identity and purity statements therefore rest on certificates of analysis, ideally issued by an independent laboratory.
Material is normally supplied as a lyophilised powder in a sealed vial. The powder is hygroscopic, so exposure to humid air leads to water uptake, caking and gradual loss of the fluffy texture that indicates a good freeze-dry. Vials are best kept sealed with desiccant, protected from light and stored cold. Letting a cold vial warm to room temperature before opening reduces condensation on the contents. Purity is normally reported from a chromatographic run, and that figure applies to the batch as tested rather than to the vial after repeated opening.
Once dissolved, the peptide is far less stable than the dry powder. Aqueous solutions are subject to hydrolysis, oxidation at susceptible residues and gradual loss of material through adsorption onto glass and plastic surfaces. Terminal glutamine can cyclise under some conditions, producing a related species that complicates purity assessment. Dilute solutions tend to lose a larger fraction of material to surfaces than concentrated ones. Buffers, pH and ionic strength all influence the rate of change, so stability figures are only meaningful when those parameters are stated alongside the storage interval.
Molecular hydrogen has the highest specific energy of any fuel. However, unless the hydrogen gas is compressed, its volumetric energy density is low, so the transportation and storage of hydrogen require energy-intensive compression and liquefaction processes. Therefore, development of new hydrogen storage methods which decrease the concomitant pressure required for practical volumetric energy density is an active area of research. MOFs attract attention as materials for adsorptive hydrogen storage because of their high specific surface areas and surface to volume ratios, as well as their chemically tunable structures. Compared to an empty gas cylinder, a MOF-filled gas cylinder can store more hydrogen at a given pressure because hydrogen molecules adsorb to the surface of MOFs. Furthermore, MOFs are free of dead-volume, so there is almost no loss of storage capacity as a result of space-blocking by non-accessible volume. Also, because the hydrogen uptake is based primarily on physisorption, many MOFs have a fully reversible uptake-and-release behavior. No large activation barriers are required when liberating the adsorbed hydrogen. The storage capacity of a MOF is limited by the liquid-phase density of hydrogen because the benefits provided by MOFs can be realized only if the hydrogen is in its gaseous state. The extent to which a gas can adsorb to a MOF's surface depends on the temperature and pressure of the gas.
=== Industrial synthesis === Glutamic acid is produced on the largest scale of any amino acid, with an estimated annual production of about 1.5 million tons in 2006. Chemical synthesis was supplanted by the aerobic fermentation of sugars and ammonia in the 1950s, with the organism Corynebacterium glutamicum (also known as Brevibacterium flavum) being the most widely used for production. Isolation and purification can be achieved by concentration and crystallization; it is also widely available as its hydrochloride salt.
Like any law, such appropriations must be introduced in Congress as a bill and passed by both the House of Representatives and the Senate and then usually be signed by the president. Typically, separate Congressional committees have jurisdiction over authorization and appropriations. The House and Senate Appropriations Committees currently have 12 subcommittees, which are responsible for drafting the 12 regular appropriations bills that determine amounts of discretionary spending for various federal programs. In many recent years, regular appropriations bills have been combined into "omnibus" bills. Congress may also pass "special" or "emergency" appropriations. Spending that is deemed an "emergency" is exempt from certain Congressional budget enforcement rules. Funds for disaster relief have sometimes come from supplemental appropriations, such as after Hurricane Katrina. In other cases, funds included in emergency supplemental appropriations bills support activities not obviously related to actual emergencies, such as parts of the 2000 Census of Population and Housing. Special appropriations have been used to fund most of the costs of war and occupation in Iraq and Afghanistan so far. Budget resolutions and appropriations bills, which reflect spending priorities of Congress, will usually differ from funding levels in the president's budget. The president, however, retains substantial influence over the budget process through veto power and through congressional allies when the president's party has a majority in Congress.
==== Actions ==== The 2C drugs act as agonists of the serotonin 5-HT2 receptors, including of the serotonin 5-HT2A, 5-HT2B, and 5-HT2C receptors. They are partial agonists of the serotonin 5-HT2A receptor. Most of the 2C drugs have much lower affinity for the serotonin 5-HT1A receptor than for the serotonin 5-HT2A receptor. Most of the 2C drugs have also shown about 5- to 15-fold higher affinity for the serotonin 5-HT2A receptor over the serotonin 5-HT2C receptor and about 15- to 100-fold higher affinity for the serotonin 5-HT2A receptor over the serotonin 5-HT1A receptor. The psychedelic effects of the 2C drugs are thought to be mediated specifically by activation of the serotonin 5-HT2A receptor. Unlike many other phenethylamines, 2C drugs, including 2C-C, 2C-D, 2C-E, 2C-I, and 2C-T-2 among others, are inactive as monoamine releasing agents and reuptake inhibitors. Most of the 2C drugs are agonists of the rat and mouse trace amine-associated receptor 1 (TAAR1). However, most are inactive as agonists of the human TAAR1. The 2C drugs show very weak monoamine oxidase inhibition, including of monoamine oxidase A (MAO-A) and/or monoamine oxidase B (MAO-B).
Sources: en.wikipedia.org
=== Harm assessment === Professor David Nutt, former chair of the Advisory Council on the Misuse of Drugs (ACMD) in the UK has said in 2009, "people are better off taking ecstasy or amphetamines than those [drugs] we know nothing about" and "Who knows what's in [mephedrone] when you buy it? We don't have a testing system. It could be very dangerous[;] we just don't know. These chemicals have never been put into animals, let alone humans." Les King, a former member of the ACMD, has stated mephedrone appears to be less potent than amphetamine and ecstasy, but that any benefit associated with this could be negated by users taking larger amounts. He also told the BBC, "all we can say is [mephedrone] is probably as harmful as ecstasy and amphetamines and wait until we have some better scientific evidence to support that."
==== Inventory in spent nuclear fuel ==== 237Np is the only neptunium isotope produced in significant quantity in the nuclear fuel cycle, both by successive neutron capture by uranium-235 (which fissions most but not all of the time) and uranium-236, or (n,2n) reactions where a fast neutron occasionally knocks a neutron loose from uranium-238 or isotopes of plutonium. Over the long term, 237Np also forms in spent nuclear fuel as the decay product of americium-241. 237Np is considered to be one of the most mobile radionuclides at the site of the Yucca Mountain nuclear waste repository (Nevada) where oxidizing conditions prevail in the unsaturated zone of the volcanic tuff above the water table.
=== Circadian rhythm === There is evidence to suggest that adropin levels exhibit a circadian rhythm, meaning they follow a natural 24-hour cycle. Circadian rhythms play a vital role in regulating various physiological processes, including sleep-wake cycles, hormone secretion, and metabolism.
Sources: en.wikipedia.org
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Meyer (1940), composer, author, philosopher known for his contributions to the aesthetic theory of music Orrin Keepnews (1943), jazz record producer and winner of the 1988 Grammy Award for Best Album Notes and Best Historical Album Mort Lindsey (1944), musical director for Judy Garland and Merv Griffin Dick Hyman (1948), musical director for Arthur Godfrey; composer or arranger for Hannah and Her Sisters and The Purple Rose of Cairo; Emmy Award winner Philip Springer (1950), composer known for writing the song "Santa Baby" Randy Starr (1951), dentist and composer for Elvis Presley Eric Salzman (1954), composer, producer, critic; founder of the American Music Theater Festival and composer-in-residence of the Center for Contemporary Opera Malcolm Frager (1955), piano virtuoso Mike Berniker (1957), musical producer and winner of nine Grammy Awards Billy Goldenberg (1957), composer and winner of four Emmy Awards John Corigliano (1959), winner of the Pulitzer Prize for Music and Academy Award for Best Original Score Edward Kleban (1959), lyricist for A Chorus Line David Bromberg* (1960s), Grammy Award-nominated musician Art Rosenbaum (1960), Grammy Award-winning art professor and musician at Georgia State University Charles Wuorinen (1961), serialist composer and winner of the Pulitzer Prize for Music for Time's Encomium Charlie Morrow (1962), sound artist and musician Joel Krosnick (1963), chamber musician and member of the Juilliard String Quartet David Rubinson (1963), record and music producer of Apocalypse Now, founder of San Francisco Records and The Automatt recording studio Art Garfunkel (1965), singer of Simon and Garfunkel, famous for the song "The Sound of Silence" Daniel Waitzman (1965), flutist and composer Kenneth Ascher (1966), Academy Award-nominated jazz pianist; writer of "Rainbow Connection" from The Muppet Movie David Schiff (1967), composer Tom Werman (1967), former record producer for Epic Records Billy Cross (1968), guitarist, singer, and producer who lives in Denmark Jon Bauman (1969), "Bowzer" of Sha Na Na James "Plunky" Branch (1969), jazz musician Cameron Brown (1969), jazz bassist Emanuel Ax (1970), concert pianist Marc Copland (1970), jazz pianist and composer Scott Simon (1970), member of Sha Na Na Frederick "Dennis" Greene (1971), member of Sha Na Na; professor of law at the University of Dayton Armen Donelian (1972), jazz pianist Jocko Marcellino (1972), member of Sha Na Na Phil Schaap (1973), Charlie Parker authority and multiple Grammy Award winner for engineering, production, and album notes Eugene Drucker (1973), Grammy Award-winning violinist, member of the Emerson String Quartet Sam Morrison (1973), saxophonist Michael Jeffrey Shapiro (1973), composer and conductor Richard Einhorn (1975), composer, Voices of Light Phil Kline (1975), composer Paul Phillips (1978), conductor, composer, and music scholar at Brown University Erik Friedlander (1982), cellist, son of American photographer Lee Friedlander Robbie Fulks* (1984), Grammy Award-nominated American alternative country singer-songwriter Dave Nachmanoff (1986), award-winning folk singer and sideman to Al Stewart John Bohlinger (1988), musician and music director on NBC program Nashville Star Laura Cantrell (1989), country musician Peter J. Nash (1989), member of 3rd Bass Mac McCaughan (1990), member of indie rockband Superchunk and founder of Merge Records Richard Carrick (1993), pianist, composer, professor at Berklee College of Music Gil Shaham (1993), violinist Jefferson Friedman (1996), composer Tom Kitt (1996), composer, co-winner of the 2010 Pulitzer Prize for Drama and the Tony Award for Best Original Score for his score of the musical Next to Normal R. Luke DuBois (1997), composer and artist Lauryn Hill* (1997), Grammy Award-winning R&B singer and songwriter, and member of The Fugees Sean Lennon* (1997), singer and songwriter, and son of John Lennon and Yoko Ono Orli Shaham (1997), pianist Yelena Dudochkin (1998), Ukrainian-American soprano Scott Hoffman (1999), known by the stage name Babydaddy, member of the rock band Scissor Sisters The Two Man Gentlemen Band, modern musical duo that consists of Fuller Condon (2000) and Andy Bean (2001) Mason Bates (2000), Grammy Award-winning composer Tom Frank (2000), journalist, former member of indie-rock band Jonathan Fire*Eater Hikaru Utada* (2000), Japanese pop star Alicia Keys* (2001), Grammy Award-winning R&B singer and songwriter Brian Weitz (2001), founding member of experimental band Animal Collective Emily and Julia Bruskin (2002), members of the Claremont Trio Ken-David Masur (2002), musical director of the Milwaukee Symphony Orchestra, son of conductor Kurt Masur Ariana Ghez (2003), oboist Nico Muhly (2003), contemporary classical music composer Anna Bulbrook (2004), violinist formerly member of indie band The Airborne Toxic Event Alisa Weilerstein (2004), cellist and 2011 MacArthur Fellow Tristan Perich (2004), contemporary composer and sound artist Peter Cincotti (2005), pianist Ellen Reid (2005), composer and recipient of the 2019 Pulitzer Prize for Music Patrick Higgins (2006), composer, musician, producer Michael Barimo (2006), pop singer and whistler Rostam Batmanglij (2006), member of alt-rock band Vampire Weekend Ezra Koenig (2006), member of alt-rock band Vampire Weekend Chris Tomson (2006), member of alt-rock band Vampire Weekend Chris Baio (2007), member of alt-rock band Vampire Weekend Call Me Ace or Anthony Patterson (2011), rapper Adam Met (2013), member of pop band AJR Danny Mercer (2013), singer, songwriter and producer Nathan Chan (2014), cellist Conrad Tao (2015), composer, pianist, violinist Jack Met* (2019), member of pop band AJR Maude Latour (2022), singer-songwriter Annie Moon (2026), member of a co-ed K-Pop Group ALLDAY PROJECT
==== Pressure ulcers ==== Another leading type of chronic wounds is pressure ulcers, which usually occur in people with conditions such as paralysis that inhibit movement of body parts that are commonly subjected to pressure such as the heels, shoulder blades, and sacrum. Pressure ulcers are caused by ischemia that occurs when pressure on the tissue is greater than the pressure in capillaries, and thus restricts blood flow into the area. Muscle tissue, which needs more oxygen and nutrients than skin does, shows the worst effects from prolonged pressure. As in other chronic ulcers, reperfusion injury damages tissue.
== Interactions == Cetacaine can have interaction with other drugs being taken by patients one of the interactions that can lead to methemoglobinemia is the interaction with sodium nitrate as well as prilocaine, which can lead to severe illness or death. As well as others listed on the referenced site.
Sources: en.wikipedia.org
The dry powder is normally kept at -20 °C, protected from light and moisture. Reconstituted solutions are often divided into aliquots and stored at -80 °C to reduce freeze-thaw damage.
Reverse-phase HPLC assesses purity, and mass spectrometry confirms molecular mass. The combination helps distinguish the target peptide from truncated or modified impurities.
Buffer composition, pH, adsorption to containers, and freeze-thaw history can all affect the amount of intact peptide in solution. These factors may change results even when the starting material is chemically correct.
It is a synthetic peptide based on a short sequence near the start of thymosin beta-4. It is supplied as a research chemical rather than as a licensed pharmaceutical product.